BAGE2 Antibody - BSA Free

Western Blot: BAGE2 Antibody [NBP3-05566] - Western blot analysis of extracts of A-431 cells, using BAGE2 antibody (NBP3-05566) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Product Discontinued

BAGE2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-109 of human BAGE2 (NP_872288.2). RLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTPFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BAGE2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 12 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BAGE2 Antibody - BSA Free

• B melanoma antigen 2
• B melanoma antigen family, member 2
• cancer/testis antigen family 2, member 2
• CT2.2Cancer/testis antigen 2.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BAGE2