B3GNT7 Antibody - BSA Free

Western Blot: B3GNT7 Antibody [NBP1-69637] - This Anti-B3GNT7 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Discontinued

B3GNT7 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to B3GNT7(UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7) The peptide sequence was selected from the N terminal of B3GNT7. Peptide sequence QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: B3GNT7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for B3GNT7 Antibody - BSA Free

• beta 1,3-N-acetylglucosaminyltransferase 7
• Beta-1,3-Gn-T7
• Beta-1,3-N-acetylglucosaminyltransferase 7
• beta3GnT7
• beta3Gn-T7
• BGnT-7
• EC 2.4.1
• EC 2.4.1.-
• UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7

Background

B3GNT7 belongs to the glycosyltransferase 31 family. It may be involved in keratane sulfate biosynthesis. B3GNT7 transfers N-acetylgalactosamine on to keratan sulfate-related glycans. It may play a role in preventing cells from migrating out of the original tissues and invading surrounding tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: B3GNT7