B3GNT7 Antibody

Images

 
Western Blot: B3GNT7 Antibody [NBP1-69637] - This Anti-B3GNT7 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GNT7 Antibody Summary

Immunogen
Synthetic peptides corresponding to B3GNT7(UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7) The peptide sequence was selected from the N terminal of B3GNT7. Peptide sequence QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GNT7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against B3GNT7 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B3GNT7 Antibody

  • beta 1,3-N-acetylglucosaminyltransferase 7
  • Beta-1,3-Gn-T7
  • Beta-1,3-N-acetylglucosaminyltransferase 7
  • beta3GnT7
  • beta3Gn-T7
  • BGnT-7
  • EC 2.4.1
  • EC 2.4.1.-
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7

Background

B3GNT7 belongs to the glycosyltransferase 31 family. It may be involved in keratane sulfate biosynthesis. B3GNT7 transfers N-acetylgalactosamine on to keratan sulfate-related glycans. It may play a role in preventing cells from migrating out of the original tissues and invading surrounding tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5316
Species: Hu
Applications: WB
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-62277
Species: Hu
Applications: WB
NBP1-89009
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45527
Species: Hu
Applications: WB, IHC, IF
NBP1-69637
Species: Hu
Applications: WB

Publications for B3GNT7 Antibody (NBP1-69637) (0)

There are no publications for B3GNT7 Antibody (NBP1-69637).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GNT7 Antibody (NBP1-69637) (0)

There are no reviews for B3GNT7 Antibody (NBP1-69637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GNT7 Antibody (NBP1-69637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GNT7 Products

Bioinformatics Tool for B3GNT7 Antibody (NBP1-69637)

Discover related pathways, diseases and genes to B3GNT7 Antibody (NBP1-69637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GNT7 Antibody (NBP1-69637)

Discover more about diseases related to B3GNT7 Antibody (NBP1-69637).
 

Pathways for B3GNT7 Antibody (NBP1-69637)

View related products by pathway.

Blogs on B3GNT7

There are no specific blogs for B3GNT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GNT7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GNT7