B3GNT7 Antibody


Western Blot: B3GNT7 Antibody [NBP1-69637] - This Anti-B3GNT7 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

B3GNT7 Antibody Summary

Synthetic peptides corresponding to B3GNT7(UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7) The peptide sequence was selected from the N terminal of B3GNT7. Peptide sequence QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against B3GNT7 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
58 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B3GNT7 Antibody

  • beta 1,3-N-acetylglucosaminyltransferase 7
  • Beta-1,3-Gn-T7
  • Beta-1,3-N-acetylglucosaminyltransferase 7
  • beta3GnT7
  • beta3Gn-T7
  • BGnT-7
  • EC 2.4.1
  • EC 2.4.1.-
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7


B3GNT7 belongs to the glycosyltransferase 31 family. It may be involved in keratane sulfate biosynthesis. B3GNT7 transfers N-acetylgalactosamine on to keratan sulfate-related glycans. It may play a role in preventing cells from migrating out of the original tissues and invading surrounding tissues.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB

Publications for B3GNT7 Antibody (NBP1-69637) (0)

There are no publications for B3GNT7 Antibody (NBP1-69637).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GNT7 Antibody (NBP1-69637) (0)

There are no reviews for B3GNT7 Antibody (NBP1-69637). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GNT7 Antibody (NBP1-69637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional B3GNT7 Antibody Products

Related Products by Gene

Bioinformatics Tool for B3GNT7 Antibody (NBP1-69637)

Discover related pathways, diseases and genes to B3GNT7 Antibody (NBP1-69637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GNT7 Antibody (NBP1-69637)

Discover more about diseases related to B3GNT7 Antibody (NBP1-69637).

Pathways for B3GNT7 Antibody (NBP1-69637)

View related products by pathway.

Blogs on B3GNT7

There are no specific blogs for B3GNT7, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol B3GNT7

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69637 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought