ZNF791 Antibody

Western Blot: ZNF791 Antibody [NBP1-80426] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Discontinued

ZNF791 Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human ZNF791. Peptide sequence ETFKNLASIGEKWEDPNVEDQHKNQGRNLRSHTGERLCEGKEGSQCAENF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF791
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ZNF791 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF791 Antibody

• FLJ90396
• MGC126179
• MGC126180
• zinc finger protein 791

Background

ZNF791 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF791
• Uniprot:
  • NP_699189(Human)