We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ZNF709 Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: ZNF709 Antibody [NBP2-13593] Staining of human cerebellum shows strong nuclear/nucleolar positivity in Purkinje cells.
Staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.
Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Staining of human liver shows no positivity in hepatocytes as expected.
Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Product Discontinued
View other related ZNF709 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-13593
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZNF709 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LQSLSAVTSSDQRRRSKEARTPGTRDTDSVVFED
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF709
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF709 Protein (NBP2-13593PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZNF709 Antibody - BSA Free

  • FLJ38281
  • zinc finger protein 709

Background

ZNF709 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF709 Antibody (NBP2-13593) (0)

There are no publications for ZNF709 Antibody (NBP2-13593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF709 Antibody (NBP2-13593) (0)

There are no reviews for ZNF709 Antibody (NBP2-13593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF709 Antibody (NBP2-13593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF709 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF709