Recombinant Human ZNF70 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF70 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-446 of Human ZNF70 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZNF70
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Reviewed Applications
Read 1 Review rated 4
using
H00007621-P01 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF70 Protein

  • Cos17
  • MGC48959
  • zinc finger protein 70 (Cos17)
  • zinc finger protein 70
  • Zinc finger protein N27C7-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for ZNF70 Recombinant Protein (H00007621-P01) (0)

There are no publications for ZNF70 Recombinant Protein (H00007621-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ZNF70 Recombinant Protein (H00007621-P01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00007621-P01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Pamela Wille
WB Human 04/05/2010
View

Summary

ApplicationWestern Blot
Sample TestedHEK whole cell lysate, Sample Amount: 40ug
SpeciesHuman
CommentsIn detection of endogenous RNF25 protein, this product works pretty well. It does recognize a seemingly non-specific band at about 35kDa.

Blocking

Blocking DetailsBlocking Buffer: 5% NFDM in TBST, Blocking Time: 2 hours, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:1000, Incubation Dilution Buffer: blocking buffer, Incubation Time: overnight, Incubation Temp: 4 C

Details

Detection NotesDetection Method: ECL, Exposure Time: 1 minute, Specific Bands: approx 60 kDa, Non-Specific Bands: approx 30 kDa

Comments

CommentsIn detection of endogenous RNF25 protein, this product works pretty well. It does recognize a seemingly non-specific band at about 35kDa.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF70 Recombinant Protein (H00007621-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF70 Products

Bioinformatics Tool for ZNF70 Recombinant Protein (H00007621-P01)

Discover related pathways, diseases and genes to ZNF70 Recombinant Protein (H00007621-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF70

There are no specific blogs for ZNF70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF70 Antibody
NBP1-84402

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Pamela Wille
04/05/2010
Application: WB
Species: Human

Bioinformatics

Gene Symbol ZNF70