ZNF605 Antibody

Western Blot: ZNF605 Antibody [NBP1-80198] - HepG2 cell lysate, concentration 2.5 ug/ml.

Product Discontinued

ZNF605 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human ZNF605. Peptide sequence NPKMWLRDNQDNLKSMERGHKYDVFGKIFNSSINIVHVGLRSHKCGTGEK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF605
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Alternate Names for ZNF605 Antibody

• zinc finger protein 605

Background

ZNF605 is a gene that codes for a protein that may be involved in transcriptional regulation that has two isoforms, measuring 641 and 672 amino acids in length, with weights of approximately 74 and 78 kDa respectively. ZNF605 has been shown to have interactions with MAPK8 in pathways such as the generic transcription and gene expression pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF605
• Uniprot:
  • NP_899061(Human)