ZNF570 Antibody

Product Discontinued

ZNF570 Antibody Summary

• Immunogen: Synthetic peptide directed towards the middle region of human ZNF570. Peptide sequence AQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHIGESLSPPNPVNHQV. The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Bovine (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF570
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000
• Application Notes: This is a rabbit polyclonal antibody against ZNF570 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF570 Antibody

• zinc finger protein 570

Background

ZNF570 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF570
• Uniprot:
  • NP_653295(Human)