ZNF341 Antibody

Images

 
Western Blot: ZNF341 Antibody [NBP1-84219] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ZNF341 Antibody [NBP1-84219] - Staining of human cell line A549 shows positivity in centrosome & nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: ZNF341 Antibody [NBP1-84219] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

ZNF341 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSIYPPSAAPTAVQQAPTPANRQISTYITVPPSPLIQTLVQGNILVSDDVLMSAMSAFTSLDQPMPQGPPPVQSSLNMHSVPSYLTQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF341
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
ZNF341 Protein (NBP1-84219PEP)

Alternate Names for ZNF341 Antibody

  • zinc finger protein 341

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF341 Antibody (NBP1-84219) (0)

There are no publications for ZNF341 Antibody (NBP1-84219).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF341 Antibody (NBP1-84219) (0)

There are no reviews for ZNF341 Antibody (NBP1-84219). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF341 Antibody (NBP1-84219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF341 Antibody Products

Bioinformatics Tool for ZNF341 Antibody (NBP1-84219)

Discover related pathways, diseases and genes to ZNF341 Antibody (NBP1-84219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF341

There are no specific blogs for ZNF341, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ZNF341

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-84219 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought