zfp-1 Antibody

Images

 
Western Blot: zfp-1 Antibody [45140002] - This image is specific to animal number SDQ3517 Dilution: 1:1,000. L1 worms were boiled in loading buffer.

Product Details

Summary
Product Discontinued
View other related zfp-1 Primary Antibodies

Order Details


    • Catalog Number
      45140002
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

zfp-1 Antibody Summary

Immunogen
In vivo generated recominant protein fragment
Epitope
EGEWFCAKCTKASAMMPGSINEATFCCQLCPFDYGALKKTDRNGWAHVICALYIPEVRFGNVHSMEPVILNDVPTDKFNKLCYICNEERPNDAKKGACMS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation 1:10-1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Western Blot 1:100-1:2000
Application Notes
This antibody is useful in Chromatin Immunoprecipitation, Western Blot, ELISA and Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for zfp-1 Antibody

  • Protein ZFP-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for zfp-1 Antibody (45140002) (0)

There are no publications for zfp-1 Antibody (45140002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for zfp-1 Antibody (45140002) (0)

There are no reviews for zfp-1 Antibody (45140002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for zfp-1 Antibody (45140002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional zfp-1 Products

Array 45140002

Research Areas for zfp-1 Antibody (45140002)

Find related products by research area.

Blogs on zfp-1

There are no specific blogs for zfp-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our zfp-1 Antibody and receive a gift card or discount.