We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ZDHHC6 Antibody

Images

 
Immunohistochemistry-Paraffin: ZDHHC6 Antibody [NBP1-82132] - Staining of human corpus, uterine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related ZDHHC6 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-82132
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZDHHC6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAF
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZDHHC6 Antibody

  • DHHC-6
  • EC 2.3.1
  • EC 2.3.1.-
  • FLJ21952
  • Transmembrane protein H4
  • Zinc finger DHHC domain-containing protein 6
  • Zinc finger protein 376
  • zinc finger, DHHC domain containing 6
  • zinc finger, DHHC-type containing 6
  • ZNF376probable palmitoyltransferase ZDHHC6

Background

ZDHHC6( AAH07213, 1 a.a. - 410 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZDHHC6 Antibody (NBP1-82132) (0)

There are no publications for ZDHHC6 Antibody (NBP1-82132).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC6 Antibody (NBP1-82132) (0)

There are no reviews for ZDHHC6 Antibody (NBP1-82132). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZDHHC6 Antibody (NBP1-82132) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDHHC6 Products

Array NBP1-82132

Research Areas for ZDHHC6 Antibody (NBP1-82132)

Find related products by research area.

Blogs on ZDHHC6

There are no specific blogs for ZDHHC6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC6