ZDHHC6 Antibody

Immunohistochemistry-Paraffin: ZDHHC6 Antibody [NBP1-82132] - Staining of human corpus, uterine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Discontinued

ZDHHC6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAF
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZDHHC6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZDHHC6 Antibody

• DHHC-6
• EC 2.3.1
• EC 2.3.1.-
• FLJ21952
• Transmembrane protein H4
• Zinc finger DHHC domain-containing protein 6
• Zinc finger protein 376
• zinc finger, DHHC domain containing 6
• zinc finger, DHHC-type containing 6
• ZNF376probable palmitoyltransferase ZDHHC6

Background

ZDHHC6( AAH07213, 1 a.a. - 410 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZDHHC6