Recombinant Human WDR53 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human WDR53 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 358 of Human WDR53 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAVKWTGGHSSPVLCLNASKEGLLASGAEGGDLTAWGEDGTPLGHTRFQGADDVTSVLFSPSCPTKLYASHGETISVLDVRSLKDSLDHFHVNEEEINCLSLNQTENLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCGLDMQVMLWSLQKARPLWITNLQEDETEEMEGPQSPGQLLNPALAHSISVASCGNIFSCGAEDGKVRIFRVMGVKCEQELGFKGHTSGVSQVCFLPESYLLLTGGNDGKITLWDANSEVEKKQKSPTKRTHRKKPKRGTCTKQGGNTNASVTDEEEHGNILPKLNIEHGEKVNWLLGTKIKGHQNILVADQTSCISVYPLNEF

Protein/Peptide Type
Recombinant Protein
Gene
WDR53

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WDR53 Protein

  • G-beta repeat-containing protein
  • MGC12928
  • MGC64882
  • WD repeat domain 53
  • WD repeat-containing protein 53

Background

This gene encodes a protein containing WD domains. The function of this gene is unknown. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for WDR53 Recombinant Protein (H00348793-P01) (0)

There are no publications for WDR53 Recombinant Protein (H00348793-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR53 Recombinant Protein (H00348793-P01) (0)

There are no reviews for WDR53 Recombinant Protein (H00348793-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR53 Recombinant Protein (H00348793-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WDR53 Products

WDR53 H00348793-P01

Bioinformatics Tool for WDR53 Recombinant Protein (H00348793-P01)

Discover related pathways, diseases and genes to WDR53 Recombinant Protein (H00348793-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for WDR53 Recombinant Protein (H00348793-P01)

View related products by pathway.

Blogs on WDR53

There are no specific blogs for WDR53, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WDR53 Antibody
NBP1-82758

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WDR53 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR53