wapl-1 Antibody

Immunocytochemistry/Immunofluorescence: wapl-1 Antibody [49300002] - This image is specific to animal number SDQ3963

Immunocytochemistry/Immunofluorescence: wapl-1 Antibody [49300002] - This image is specific to animal number SDQ3947 Images are wild type. Dilution of affinity purified antibody is at 1:10,000.

Immunocytochemistry/Immunofluorescence: wapl-1 Antibody [49300002] - This image is specific to animal number SDQ3947

Immunocytochemistry/Immunofluorescence: wapl-1 Antibody [49300002] - This image is specific to animal number SDQ3963

Product Discontinued

wapl-1 Antibody Summary

• Immunogen: In vivo generated recominant protein fragment
• Epitope: SSDANSDDPFSKPIVRKRFQATLAQQGIEDDQLPSVRSSDSPDVPDTPDVPVNQLSSPPLSLPETLSEGNAETNLSDD SEPEMLSQSSTSSLNRRMEDSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Western Blot
• Application Notes: This product is useful for ELISA and for Immunofluorescence. Use in Western blot reported in scientific literature (PMID: 29768402). Use in Immunohistochemistry reported in scientific literature (PMID:30936182).

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for wapl-1 Antibody

• WAPL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for wapl-1 Antibody (49300002)(4)

Publications using 49300002

• Schedl T, Chen J, Mohammad A, Pazdernik N GLP-1 Notch-LAG-1 CSL control of the germline stem cell fate is mediated by transcriptional targets lst-1 and sygl-1 PLoS Genet 2020-03-21 [PMID: 32196486]
• Kocsisova, Z;Kornfeld, K;Schedl, T; Rapid population-wide declines in stem cell number and activity during reproductive aging in C. elegans Development 2019-04-23 [PMID: 30936182] (IF/IHC, C. elegans)
• Kocsisova Z, Kornfeld K, Schedl T. Cell cycle accumulation of the proliferating cell nuclear antigen PCN-1 transitions from continuous in the adult germline to intermittent in the early embryo of C. elegans BMC Dev. Biol. 2018-05-30 [PMID: 29848313] (ICC/IF, C. elegans)
• Hernandez M. R, Davis M. B, et al. Condensin I protects meiotic cohesin from WAPL-1 mediated removal. PLoS Genet 2018-05-01 [PMID: 29768402] (ICC/IF, WB, C. elegans)