TYMS opposite strand Antibody

Western Blot: C18orf56 Antibody [NBP1-57050] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Discontinued

TYMS opposite strand Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to C18orf56 (chromosome 18 open reading frame 56) The peptide sequence was selected from the N terminal of C18orf56. Peptide sequence MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C18ORF56
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TYMS opposite strand Antibody

• chromosome 18 open reading frame 56
• putative uncharacterized protein C18orf56

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C18ORF56
• Uniprot:
  • Q8TAI1(Human)