TTC38 Antibody

Images

 
Western Blot: TTC38 Antibody [NBP2-83724] - Host: Rabbit. Target Name: TTC38. Sample Tissue: Mouse Small Intestine lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTC38 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of mouse TTC38. Peptide sequence: VFNQLLIHAAMTCTSSVHKNVARSLLMERDALKPNSPLTERLIRRAAAVH The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TTC38
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC38 Antibody

  • FLJ20699
  • tetratricopeptide repeat domain 38
  • tetratricopeptide repeat protein 38
  • TPR repeat protein 38

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTC38 Antibody (NBP2-83724) (0)

There are no publications for TTC38 Antibody (NBP2-83724).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC38 Antibody (NBP2-83724) (0)

There are no reviews for TTC38 Antibody (NBP2-83724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC38 Antibody (NBP2-83724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TTC38 Products

Bioinformatics Tool for TTC38 Antibody (NBP2-83724)

Discover related pathways, diseases and genes to TTC38 Antibody (NBP2-83724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TTC38

There are no specific blogs for TTC38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC38 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC38