![Western Blot: TRIM48 Antibody [NBP1-79458] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/TRIM48-Antibody-Western-Blot-NBP1-79458-img0002.jpg "Western Blot: TRIM48 Antibody [NBP1-79458] - Human Liver cell lysate, concentration 0.2-1 ug/ml.")
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide directed towards the C terminal of human TRIM48The immunogen for this antibody is TRIM48. Peptide sequence NVETTRISHWKAFGDILYRSESVLLHMPQPLNLALRAGPITGLRDRLNQF. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRIM48 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TRIM48 Antibody (NBP1-79458)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
