THEM6 Antibody

Images

 
Western Blot: THEM6 Antibody [NBP2-85908] - WB Suggested Anti-4930572J05Rik Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Stomach

Product Details

Summary
Reactivity Mu, Hu, Rt, Ca, GpSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THEM6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse THEM6. Peptide sequence: RRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLG The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Canine (93%), Guinea Pig (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
THEM6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for THEM6 Antibody

  • C8orf55
  • chromosome 8 open reading frame 55
  • DSCD75
  • Mesenchymal stem cell protein DSCD75
  • thioesterase superfamily member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for THEM6 Antibody (NBP2-85908) (0)

There are no publications for THEM6 Antibody (NBP2-85908).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THEM6 Antibody (NBP2-85908) (0)

There are no reviews for THEM6 Antibody (NBP2-85908). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for THEM6 Antibody (NBP2-85908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional THEM6 Products

Bioinformatics Tool for THEM6 Antibody (NBP2-85908)

Discover related pathways, diseases and genes to THEM6 Antibody (NBP2-85908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on THEM6

There are no specific blogs for THEM6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THEM6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THEM6