![Immunocytochemistry/Immunofluorescence: SYNPO2L Antibody [NBP2-34156] - Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles & cytosol.](http://images.novusbio.com/fullsize/SYNPO2L-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34156-img0007.jpg "Immunocytochemistry/Immunofluorescence: SYNPO2L Antibody [NBP2-34156] - Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles & cytosol.")
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PVAPKPPSRGLLDGLVNGAASSAGIPEPPRLQGRGGELFAKRQSRADRYVVEGTPGPGLGPR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SYNPO2L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SYNPO2L Antibody (NBP2-34156)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SYNPO2L Antibody [NBP2-34156] - Staining in human heart muscle and skin tissues using anti-SYNPO2L antibody. Corresponding SYNPO2L RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SYNPO2L-Antibody-Immunohistochemistry-Paraffin-NBP2-34156-img0010.jpg "Immunohistochemistry-Paraffin: SYNPO2L Antibody [NBP2-34156] - Staining in human heart muscle and skin tissues using anti-SYNPO2L antibody. Corresponding SYNPO2L RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SYNPO2L Antibody [NBP2-34156] - Staining of human heart muscle shows strong cytoplasmic and membranous positivity in myocytes.](http://images.novusbio.com/fullsize/SYNPO2L-Antibody-Immunohistochemistry-Paraffin-NBP2-34156-img0008.jpg "Immunohistochemistry-Paraffin: SYNPO2L Antibody [NBP2-34156] - Staining of human heart muscle shows strong cytoplasmic and membranous positivity in myocytes.")
![Immunohistochemistry-Paraffin: SYNPO2L Antibody [NBP2-34156] - Staining of human skin shows low expression as expected.](http://images.novusbio.com/fullsize/SYNPO2L-Antibody-Immunohistochemistry-Paraffin-NBP2-34156-img0009.jpg "Immunohistochemistry-Paraffin: SYNPO2L Antibody [NBP2-34156] - Staining of human skin shows low expression as expected.")