![Western Blot: Synaptogyrin 4 Antibody [NBP1-87530] - Analysis in control (vector only transfected HEK293T lysate) and SYNGR4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Synaptogyrin-4-Antibody-Western-Blot-NBP1-87530-img0007.jpg "Western Blot: Synaptogyrin 4 Antibody [NBP1-87530] - Analysis in control (vector only transfected HEK293T lysate) and SYNGR4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSPVNMPTTGPNSLSYASSALSPCLTAPKSPRLAMMPDN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SYNGR4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | HIER pH6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Synaptogyrin 4 Antibody (NBP1-87530)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SYNGR4 |
![Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining in human testis and endometrium tissues using anti-SYNGR4 antibody. Corresponding SYNGR4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Synaptogyrin-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87530-img0006.jpg "Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining in human testis and endometrium tissues using anti-SYNGR4 antibody. Corresponding SYNGR4 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining of human small intestine shows distinct membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Synaptogyrin-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87530-img0002.jpg "Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining of human small intestine shows distinct membranous and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/Synaptogyrin-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87530-img0004.jpg "Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/Synaptogyrin-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87530-img0005.jpg "Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining of human testis shows high expression.")