Recombinant Human SPDYE2 Protein (H00441273-P01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPDYE2 Protein Summary

Description
SPDYE2 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKRWFQLGHSMNPRARKNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
SPDYE2

Applications/Dilutions

Application Notes
Western blot, ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPDYE2 Protein

  • MGC119295
  • putative Speedy protein E2
  • speedy homolog E2 (Xenopus laevis)
  • speedy protein E2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for SPDYE2 Recombinant Protein (H00441273-P01) (0)

There are no publications for SPDYE2 Recombinant Protein (H00441273-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPDYE2 Recombinant Protein (H00441273-P01) (0)

There are no reviews for SPDYE2 Recombinant Protein (H00441273-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPDYE2 Recombinant Protein (H00441273-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPDYE2 Products

Bioinformatics Tool for SPDYE2 Recombinant Protein (H00441273-P01)

Discover related pathways, diseases and genes to SPDYE2 Recombinant Protein (H00441273-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPDYE2

There are no specific blogs for SPDYE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SPDYE2 Antibody
NBP2-46794
SPDYE2 Antibody
NBP2-46794

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPDYE2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPDYE2