SPANXN4 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPANXN4 Antibody [NBP1-94095] Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Staining of human skin shows no positivity in squamous epithelial cells as expected.

Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.

Product Discontinued

SPANXN4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEKGDLDISAGSPQDGEEEKDLVFLGARACLEEHIRRSVLYVGDSDTLSKMKTSESPPSGHIPQSGVFCNSPNAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPANXN4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SPANXN4 Antibody - BSA Free

• CT11.9
• member 9
• nuclear-associated protein SPAN-Xn4
• SPANX family, member N4
• sperm protein associated with the nucleus on the X chromosome N4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPANXN4