SLC18B1 Antibody

Images

 
Western Blot: C6orf192 Antibody [NBP1-70475] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related SLC18B1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-70475
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SLC18B1 Antibody Summary

Immunogen
Synthetic peptides corresponding to C6ORF192 The peptide sequence was selected from the N terminal of C6ORF192. Peptide sequence ISAASVNLGSMMCYSILGPFFPKEAEKKGASNTIIGMIFGCFALFELLAS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%), Porcine (93%), Bovine (93%), Rabbit (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC18B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C6orf192 and was validated on Western blot.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC18B1 Antibody

  • C6orf192
  • chromosome 6 open reading frame 192
  • dJ55C23.6
  • MFS-type transporter C6orf192
  • solute carrier family 18, subfamily B, member 1

Background

The exact function of C6orf192 remains unknown.This gene encodes a protein, which has high sequence similarity to rat, xenopus and zebrafish proteins. The protein function is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC18B1 Antibody (NBP1-70475) (0)

There are no publications for SLC18B1 Antibody (NBP1-70475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC18B1 Antibody (NBP1-70475) (0)

There are no reviews for SLC18B1 Antibody (NBP1-70475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC18B1 Antibody (NBP1-70475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC18B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC18B1