![Immunocytochemistry/Immunofluorescence: scc-1 Antibody [29510002] - This image is specific to animal number SDQ0821 Dilution: 1:500](http://images.novusbio.com/fullsize/scc-1-Antibody-Immunocytochemistry-Immunofluorescence-29510002-img0004.jpg "Immunocytochemistry/Immunofluorescence: scc-1 Antibody [29510002] - This image is specific to animal number SDQ0821 Dilution: 1:500")
| Immunogen | In vivo generated recombinant protein fragment |
| Epitope | TPSMEAQAEPWEDLNLNEDIQEDIQAQGPAVDEFFNDVRMDDDDDRQPAQEMDFGDNFDFPQEVEHQECAPIPIQSGFAGENKENEDAEDWSDPFGSSNS |
| Specificity | Caenorhabditis elegans SCC1 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This product is useful for ELISA and for Immunofluorescence. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Concentration | 1 mg/ml |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
-(005-ml)_29510002_8956.jpg)
Enlarge |
reviewed by:
Verified Customer |
WB | Other | 07/22/2014 |
Summary
|
||||||
-(005-ml)_29510002_8951.jpg)
Enlarge |
reviewed by:
Verified Customer |
WB | Other | 07/22/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for scc-1 Antibody (29510002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 07/22/2014 |
||
| Application: | WB | |
| Species: | Other |
| Verified Customer 07/22/2014 |
||
| Application: | WB | |
| Species: | Other |
![Immunocytochemistry/Immunofluorescence: scc-1 Antibody [29510002] - This image is specific to animal number SDQ0835 1:1000; Methanol fixation; 1 hr](http://images.novusbio.com/fullsize/scc-1-Antibody-Immunocytochemistry-Immunofluorescence-29510002-img0003.jpg "Immunocytochemistry/Immunofluorescence: scc-1 Antibody [29510002] - This image is specific to animal number SDQ0835 1:1000; Methanol fixation; 1 hr")
-(005-ml)_29510002_8956.jpg)
-(005-ml)_29510002_8951.jpg)