SARS Nucleocapsid Protein Antibody (AP201054) [Janelia Fluor® 635]

Images

 

Product Details

Summary
Product Discontinued
View other related SARS Nucleocapsid Protein Primary Antibodies

Order Details


    • Catalog Number
      NBP2-90967JF635
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SARS Nucleocapsid Protein Antibody (AP201054) [Janelia Fluor® 635] Summary

Immunogen
The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
N
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Direct ELISA
  • ELISA
  • Immunoassay
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Reactivity Notes

Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein G purified

Notes



Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for SARS Nucleocapsid Protein Antibody (AP201054) [Janelia Fluor® 635]

  • N protein
  • N structural protein
  • N
  • NC
  • Nucleocapsid protein
  • Nucleoprotein
  • Protein N
  • SARS coronavirus N protein
  • SARS coronavirus nucleocapsid protein
  • SARS CoV N protein
  • SARS CoV nucleocapsid protein
  • SARS CoV
  • SARS N protein
  • SARS Nucleoprotein
  • SARSCoV N protein
  • SARSCoV nucleocapsid protein
  • SARSCoV
  • Severe acute respiratory syndrome

Background

It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SARS Nucleocapsid Protein Antibody (NBP2-90967JF635) (0)

There are no publications for SARS Nucleocapsid Protein Antibody (NBP2-90967JF635).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967JF635) (0)

There are no reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967JF635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SARS Nucleocapsid Protein Antibody (NBP2-90967JF635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS Nucleocapsid Protein Antibody (AP201054) [Janelia Fluor® 635] and receive a gift card or discount.

Bioinformatics

Gene Symbol N