| Immunogen | In vivo generated recominant protein fragment |
| Epitope | LSLENLFDEIERKNKILIPGKNGKEKEDFLKDLKKIMPKLLSALTIDTETGDLTWNEAAVTTDSPIHEYMEDDLHYYVVDYVKMLDKARFRVTDEAERLS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This product is useful in ELISA and Western Blot. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Concentration | 1 mg/ml |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for rsd-6 Antibody (43250002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.