RPL23AP82 Antibody

Images

 
Western Blot: RPL23AP82 Antibody [NBP1-57370] - Human Stomach, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL23AP82 Antibody Summary

Immunogen
Synthetic peptides corresponding to MGC70863(similar to RPL23AP7 protein) The peptide sequence was selected from the N terminal of MGC70863. Peptide sequence MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL23AP82
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MGC70863 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPL23AP82 Antibody

  • MGC70863
  • ribosomal protein L23a pseudogene 82
  • RPL23A_43_1761

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPL23AP82 Antibody (NBP1-57370) (0)

There are no publications for RPL23AP82 Antibody (NBP1-57370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL23AP82 Antibody (NBP1-57370) (0)

There are no reviews for RPL23AP82 Antibody (NBP1-57370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL23AP82 Antibody (NBP1-57370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RPL23AP82 Antibody (NBP1-57370)

Discover related pathways, diseases and genes to RPL23AP82 Antibody (NBP1-57370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RPL23AP82

There are no specific blogs for RPL23AP82, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL23AP82 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL23AP82