We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

rec-8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: rec-8 Antibody [49230002] - This image is specific to animal number SDQ3953
Immunocytochemistry/ Immunofluorescence: rec-8 Antibody [49230002] - This image is specific to animal number SDQ3914 Wild type. Affinity purified antibody at 1:10,000.
Immunocytochemistry/ Immunofluorescence: rec-8 Antibody [49230002] - This image is specific to animal number SDQ3953 Images are wild type. Dilution is at 1:10,000 with affinity purified antibody.

Product Details

Summary
Product Discontinued
View other related rec-8 Primary Antibodies

Order Details


    • Catalog Number
      49230002
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

rec-8 Antibody Summary

Immunogen
In vivo generated recominant protein fragment
Epitope
IDNNSELNAIYGCVEPYLREKEITMHSTFVEGNGSNEHNKERRNDAVIADFSQLLFPEIPEITLGEKFPIDVDSRKRS AILQEEQEEALQLPKEASEIVQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
Application Notes
This product is useful for ELISA and for Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for rec-8 Antibody (49230002) (0)

There are no publications for rec-8 Antibody (49230002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for rec-8 Antibody (49230002) (0)

There are no reviews for rec-8 Antibody (49230002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for rec-8 Antibody (49230002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Research Areas for rec-8 Antibody (49230002)

Find related products by research area.

Blogs on rec-8

There are no specific blogs for rec-8, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our rec-8 Antibody and receive a gift card or discount.