RADX Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: KQVKPEWRLPKLNHRFTTRSELDDMPENCICDVIGLLVFVGRVQRSKKKENREDFWSYRWIHIADGTSEQPFIVELFSTSQPEIFENIYPMAYFVCTQLKVVRNDNQVPKL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CXORF57 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for RADX Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for RADX Antibody (NBP2-13887)(5)
Showing Publications 1 -
5 of 5.
| Publications using NBP2-13887 |
Applications |
Species |
| Krishnamoorthy A, Jackson J, Mohamed T et al. RADX prevents genome instability by confining replication fork reversal to stalled forks Molecular cell 2021-05-29 [PMID: 34107305] |
|
|
| Townsend A, Lora G, Engel J, et al. DCAF14 promotes stalled fork stability to maintain genome integrity Cell reports 2021-01-26 [PMID: 33503431] |
|
|
| Adolph MB, Mohamed TM, Balakrishnan S, et al. RADX controls RAD51 filament dynamics to regulate replication fork stability Molecular cell 2021-01-08 [PMID: 33453169] |
|
|
| Rickman KA, Noonan R, Lach FP et al. Distinct roles of BRCA2 in replication fork protection in response to hydroxyurea and DNA interstrand crosslinks Genes Dev 2020-05-02 [PMID: 32354836] |
|
|
| Dungrawala H, Bhat KP, Le Meur R et al. RADX Promotes Genome Stability and Modulates Chemosensitivity by Regulating RAD51 at Replication Forks Mol. Cell 2017-07-19 [PMID: 28735897] |
|
|
Reviews for RADX Antibody (NBP2-13887) (0)
There are no reviews for RADX Antibody (NBP2-13887).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RADX Antibody (NBP2-13887) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RADX Products
Blogs on RADX