RADX Antibody

Immunocytochemistry/Immunofluorescence: RADX Antibody [NBP2-13887] - Staining of human cell line A-431 shows localization to intermediate filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RADX Antibody [NBP2-13887] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: RADX Antibody [NBP2-13887] - Staining of human endometrium shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: RADX Antibody [NBP2-13887] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: RADX Antibody [NBP2-13887] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: RADX Antibody [NBP2-13887] - Staining of human adrenal gland shows moderate membranous positivity in glandular cells.

Product Discontinued

RADX Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KQVKPEWRLPKLNHRFTTRSELDDMPENCICDVIGLLVFVGRVQRSKKKENREDFWSYRWIHIADGTSEQPFIVELFSTSQPEIFENIYPMAYFVCTQLKVVRNDNQVPKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CXORF57
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RADX Antibody

• chromosome X open reading frame 57
• CXorf57
• RP11-647M7.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RADX Antibody (NBP2-13887)(5)

Publications using NBP2-13887

• Krishnamoorthy A, Jackson J, Mohamed T et al. RADX prevents genome instability by confining replication fork reversal to stalled forks Molecular cell 2021-05-29 [PMID: 34107305]
• Townsend A, Lora G, Engel J, et al. DCAF14 promotes stalled fork stability to maintain genome integrity Cell reports 2021-01-26 [PMID: 33503431]
• Adolph MB, Mohamed TM, Balakrishnan S, et al. RADX controls RAD51 filament dynamics to regulate replication fork stability Molecular cell 2021-01-08 [PMID: 33453169]
• Rickman KA, Noonan R, Lach FP et al. Distinct roles of BRCA2 in replication fork protection in response to hydroxyurea and DNA interstrand crosslinks Genes Dev 2020-05-02 [PMID: 32354836]
• Dungrawala H, Bhat KP, Le Meur R et al. RADX Promotes Genome Stability and Modulates Chemosensitivity by Regulating RAD51 at Replication Forks Mol. Cell 2017-07-19 [PMID: 28735897]

Bioinformatics

• Gene Symbol: CXORF57