Recombinant Human Protocadherin beta 3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Protocadherin beta 3 Protein Summary

Description
Protocadherin beta 3 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ASEEIRKTFQLNPITGDMQLVKYLNFEAINSYEVDIEAKDGGGLSGKSTVIVQVVDVNDNPPELTLSSVNSPIPENSGETVLAVFSVSDLDSGDNGRV
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCDHB3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Protocadherin beta 3 Protein

  • PCDH-BETA3
  • PCDH-beta-3
  • protocadherin beta 3
  • protocadherin beta-3

Background

PCDHB3 - protocadherin beta 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Protocadherin beta 3 Partial Recombinant Protein (H00056132-Q01) (0)

There are no publications for Protocadherin beta 3 Partial Recombinant Protein (H00056132-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin beta 3 Partial Recombinant Protein (H00056132-Q01) (0)

There are no reviews for Protocadherin beta 3 Partial Recombinant Protein (H00056132-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin beta 3 Partial Recombinant Protein (H00056132-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protocadherin beta 3 Products

Bioinformatics Tool for Protocadherin beta 3 Partial Recombinant Protein (H00056132-Q01)

Discover related pathways, diseases and genes to Protocadherin beta 3 Partial Recombinant Protein (H00056132-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Protocadherin beta 3

There are no specific blogs for Protocadherin beta 3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Protocadherin beta 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHB3

Customers Who Bought This Also Bought