Protocadherin beta 3 Antibody

Immunocytochemistry/Immunofluorescence: Protocadherin beta 3 Antibody [NBP2-33595] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles.

Immunohistochemistry-Paraffin: Protocadherin beta 3 Antibody [NBP2-33595] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Product Discontinued

Protocadherin beta 3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FQLNPITGDMQLVKYLNFEAINSYEVDIEAKDGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCDHB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Protocadherin beta 3 Antibody

• PCDH-BETA3
• PCDH-beta-3
• protocadherin beta 3
• protocadherin beta-3

Background

The Protocadherin beta 3 gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked onchromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cellreceptor gene clusters. T

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCDHB3
• Uniprot:
  • Q9Y5E6(Human)