We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Protocadherin beta 3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Protocadherin beta 3 Antibody [NBP2-33595] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles.
Immunohistochemistry-Paraffin: Protocadherin beta 3 Antibody [NBP2-33595] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Product Discontinued
View other related Protocadherin beta 3 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-33595
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Protocadherin beta 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FQLNPITGDMQLVKYLNFEAINSYEVDIEAKDGG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDHB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Protocadherin beta 3 Antibody

  • PCDH-BETA3
  • PCDH-beta-3
  • protocadherin beta 3
  • protocadherin beta-3

Background

The Protocadherin beta 3 gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked onchromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cellreceptor gene clusters. T

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Protocadherin beta 3 Antibody (NBP2-33595) (0)

There are no publications for Protocadherin beta 3 Antibody (NBP2-33595).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin beta 3 Antibody (NBP2-33595) (0)

There are no reviews for Protocadherin beta 3 Antibody (NBP2-33595). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Protocadherin beta 3 Antibody (NBP2-33595) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin beta 3 Products

Blogs on Protocadherin beta 3

There are no specific blogs for Protocadherin beta 3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin beta 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHB3
Uniprot