Protein hunchback Antibody

Images

 
Western Blot: Protein hunchback Antibody [NBP3-09253] - Western blot analysis of Protein hunchback in Drosophila as a positive control. Antibody dilution at 0.2-1 ug/ml

Product Details

Summary
Reactivity DrSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protein hunchback Antibody Summary

Immunogen
The immunogen is a synthetic peptide corresponding to a middle region of Drosophila Protein hunchback (NP_731268). Peptide sequence MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
Clonality
Polyclonal
Host
Rabbit
Gene
hb
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Protein hunchback Antibody (NBP3-09253) (0)

There are no publications for Protein hunchback Antibody (NBP3-09253).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein hunchback Antibody (NBP3-09253) (0)

There are no reviews for Protein hunchback Antibody (NBP3-09253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protein hunchback Antibody (NBP3-09253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Protein hunchback Products

Array NBP3-09253

Bioinformatics Tool for Protein hunchback Antibody (NBP3-09253)

Discover related pathways, diseases and genes to Protein hunchback Antibody (NBP3-09253). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Protein hunchback

There are no specific blogs for Protein hunchback, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein hunchback Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol hb