Protein hunchback Antibody

Images

 
Western Blot: Protein hunchback Antibody [NBP3-09253] - Western blot analysis of Protein hunchback in Drosophila as a positive control. Antibody dilution at 0.2-1 ug/ml

Product Details

Summary
Product Discontinued
View other related Protein hunchback Primary Antibodies

Order Details


    • Catalog Number
      NBP3-09253
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Protein hunchback Antibody Summary

Immunogen
The immunogen is a synthetic peptide corresponding to a middle region of Drosophila Protein hunchback (NP_731268). Peptide sequence MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
Clonality
Polyclonal
Host
Rabbit
Gene
hb
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Protein hunchback Antibody

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Protein hunchback Antibody (NBP3-09253) (0)

There are no publications for Protein hunchback Antibody (NBP3-09253).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein hunchback Antibody (NBP3-09253) (0)

There are no reviews for Protein hunchback Antibody (NBP3-09253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protein hunchback Antibody (NBP3-09253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein hunchback Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol hb