Recombinant S. aureus Protein A Protein

Images

 
SDS-Page: Recombinant S. aureus Protein A Protein [NBP3-07005] - Protein A, 48.1 kDa (434aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE.

Product Details

Summary
Reactivity BaSpecies Glossary
Applications PAGE
Concentration
1 mg/ml

Order Details

Recombinant S. aureus Protein A Protein Summary

Description
An un-tagged recombinant protein corresponding to the amino acids 37-469 of Protein A

Source: E.coli

Amino Acid Sequence: MAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDNKKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPET
Source
E. coli
Protein/Peptide Type
Recombinant Protein
Gene
SAOUHSC_00069
Purity
>90%, by SDS-PAGE
Endotoxin Note
< 1.0 EU per 1 microgram of protein (determined by LAL method)

Applications/Dilutions

Dilutions
  • SDS-Page
Theoretical MW
48.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl buffer (pH 8.0), 10% glycerol
Preservative
No Preservative
Concentration
1 mg/ml
Purity
>90%, by SDS-PAGE

Alternate Names for Recombinant S. aureus Protein A Protein

  • Immunoglobulin G binding protein A
  • PROA
  • Protein A
  • Protein-A
  • SPA
  • Staphylococcal protein A

Background

Protein A is a surface protein of S.aureus which binds IgG molecules by their Fc region. In serum, the bacteria will bind IgG molecules in the wrong orientation on their surface which hinders opsonization and phagocytosis. Mutants of S. aureus lacking protein A are more efficiently phagocytosed in vitro, and mutants in infection models have diminished virulence. Due to its affinity for the Fc region of many mammalian immunoglobulins, protein A is considered a universal reagent in biochemistry and immunology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for Protein A Recombinant Protein (NBP3-07005) (0)

There are no publications for Protein A Recombinant Protein (NBP3-07005).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein A Recombinant Protein (NBP3-07005) (0)

There are no reviews for Protein A Recombinant Protein (NBP3-07005). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Protein A Recombinant Protein (NBP3-07005). (Showing 1 - 1 of 1 FAQ).

  1. During my master thesis, I am working on a large scale ribosome affinity purification in Trypanosoma brucei. Unfortunately, we have some problems with the present antibody (IgG against protein A, extracted from chicken). Therefore, we are searching a better and more efficient alternative. Ideally it is extracted from guinea pig, rat, mouse or rabbit. Searching suitable antibodies, I found you have some in your range of products. Since we need to work large scale and will need a bigger amount of antibodies the next months, we would like to get the possibility to test the new antibodies first. Therefore I would like to ask for an aliquot for testing. You would really help me finding an good alternative!
    • We unfortunately cannot offer testing samples of our antibodies. I am sorry for any inconvenience. We do have two antibodies to Protein A that meet your host requirements. We fully guarantee our antibodies for all listed species and applications. For any applications and/or species not listed, we offer our Innovators Reward Program. In exchange for a review of your experiment using our product in an untested application or species, we will issue you a credit for the purchase price of the antibody.

Additional Protein A Products

Research Areas for Protein A Recombinant Protein (NBP3-07005)

Find related products by research area.

Blogs on Protein A

There are no specific blogs for Protein A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant S. aureus Protein A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SAOUHSC_00069