PPP5D1 Antibody

Immunohistochemistry: PPP5D1 Antibody [NBP2-68950] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Discontinued

PPP5D1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AEMRAWRPLVRPSLQCVKLGRATARWWWVVKVKPHD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP5D1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for PPP5D1 Antibody

• PPP5 Tetratricopeptide Repeat Domain Containing 1
• PPP5 TPR Repeat Domain-Containing Protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP5D1