PHF21B Antibody


Western Blot: PHF21B Antibody [NBP2-30660] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunohistochemistry: PHF21B Antibody [NBP2-30660] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PHF21B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VTGPQVSSLQRLAGQGAAVLPQVRPKTLIPDSLPVAPGRDRPPKQPPTFQKATVVSVKNPSPALPTANNTVSHVP
Specificity of human PHF21B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PHF21B Protein (NBP2-30660PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PHF21B Antibody

  • BHC80L
  • FLJ34161
  • KIAA1661
  • PHD finger protein 21B
  • PHD finger protein 4
  • PHF4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHF21B Antibody (NBP2-30660) (0)

There are no publications for PHF21B Antibody (NBP2-30660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF21B Antibody (NBP2-30660) (0)

There are no reviews for PHF21B Antibody (NBP2-30660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF21B Antibody (NBP2-30660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PHF21B Products

Bioinformatics Tool for PHF21B Antibody (NBP2-30660)

Discover related pathways, diseases and genes to PHF21B Antibody (NBP2-30660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PHF21B

There are no specific blogs for PHF21B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PHF21B Antibody and receive a gift card or discount.


Gene Symbol PHF21B