PCDH19 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PCDH19 Antibody [NBP1-83995] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: PCDH19 Antibody [NBP1-83995] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCDH19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLIKSSSTFKDLEGNSLKDSGHEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMGSQMPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDH19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCDH19 Protein (NBP1-83995PEP)
Publications
Read Publication using
NBP1-83995 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCDH19 Antibody

  • EFMR
  • EIEE9protocadherin-19
  • epilepsy, female restricted, with mental retardation (Juberg-Hellman syndrome)
  • KIAA1313DKFZp686P1843
  • protocadherin 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58876
Species: Hu
Applications: ICC/IF
NBP2-32157
Species: Hu
Applications: WB, IHC-P, IP
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
AF5434
Species: Hu
Applications: WB, ICC
AF7669
Species: Hu, Mu, Rt
Applications: WB
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-04544
Species: Hu
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46340
Species: Hu
Applications: WB, IHC, IF
NBL1-14149
Species: Hu
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87257
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
35740002
Species: Hu
Applications: WB, ELISA
AF7068
Species: Hu
Applications: WB, IHC, ICC
H00028513-B01P
Species: Hu
Applications: WB, ELISA
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-83995
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PCDH19 Antibody (NBP1-83995)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PCDH19 Antibody (NBP1-83995) (0)

There are no reviews for PCDH19 Antibody (NBP1-83995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCDH19 Antibody (NBP1-83995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCDH19 Products

Bioinformatics Tool for PCDH19 Antibody (NBP1-83995)

Discover related pathways, diseases and genes to PCDH19 Antibody (NBP1-83995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDH19 Antibody (NBP1-83995)

Discover more about diseases related to PCDH19 Antibody (NBP1-83995).
 

Pathways for PCDH19 Antibody (NBP1-83995)

View related products by pathway.

Blogs on PCDH19

There are no specific blogs for PCDH19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCDH19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH19
Entrez
Uniprot