Recombinant Human PARP11 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human PARP11 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-331 of Human PARP11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
PARP11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot Western Blot
Theoretical MW
65.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PARP11 GST (N-Term) Protein

  • ARTD11
  • C12orf6
  • chromosome 12 open reading frame 6
  • DKFZp779H0122
  • EC 2.4.2.30
  • MIB006
  • PARP11
  • PARP-11
  • poly (ADP-ribose) polymerase family, member 11
  • poly [ADP-ribose] polymerase 11

Background

Poly (ADP-ribose) polymerase (PARP) catalyzes the post-translational modification of proteins by the addition ofmultiple ADP-ribose moieties. PARP transfers ADP-ribose from nicotinamide dinucleotide (NAD) to glu/asp residues onthe substrate protein, and also polymerizes ADP-ribose to form long/branched chain polymers. PARP inhibitors are beingdeveloped for use in a number of pathologies including cancer, diabetes, stroke and cardiovascular disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for PARP11 Recombinant Protein (H00057097-P01) (0)

There are no publications for PARP11 Recombinant Protein (H00057097-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP11 Recombinant Protein (H00057097-P01) (0)

There are no reviews for PARP11 Recombinant Protein (H00057097-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARP11 Recombinant Protein (H00057097-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PARP11 Products

Array H00057097-P01

Research Areas for PARP11 Recombinant Protein (H00057097-P01)

Find related products by research area.

Blogs on PARP11

There are no specific blogs for PARP11, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PARP11 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PARP11