OR5H6 Antibody - BSA Free

Western Blot: OR5H6 Antibody [NBP3-10252] - Western blot analysis of OR5H6 in Mouse Brain lysates. Antibody dilution at 1ug/ml

Product Discontinued

OR5H6 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse OR5H6. Peptide sequence VHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVIDSLAKFLKRNV
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OR5H6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OR5H6 Antibody - BSA Free

• olfactory receptor 5H6
• Olfactory receptor OR3-11
• olfactory receptor, family 5, subfamily H, member 6
• OR3-11

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OR5H6