OR52E2 Antibody

Images

 
Immunohistochemistry-Paraffin: OR52E2 Antibody [NBP1-92229] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: OR52E2 Antibody [NBP1-92229] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: OR52E2 Antibody [NBP1-92229] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: OR52E2 Antibody [NBP1-92229] - Staining of human hippocampus shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: OR52E2 Antibody [NBP1-92229] - Staining of human tonsil shows no positivity in germinal center cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OR52E2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RTKQIYKCVKKILLQEQGMEKEEYLIHTRF
Specificity
Specificity of human OR52E2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OR52E2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OR52E2 Antibody

  • olfactory receptor 52E2
  • olfactory receptor, family 10, subfamily AC, member 1 pseudogene
  • olfactory receptor, family 52, subfamily E, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OR52E2 Antibody (NBP1-92229) (0)

There are no publications for OR52E2 Antibody (NBP1-92229).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR52E2 Antibody (NBP1-92229) (0)

There are no reviews for OR52E2 Antibody (NBP1-92229). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OR52E2 Antibody (NBP1-92229) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OR52E2 Products

Bioinformatics Tool for OR52E2 Antibody (NBP1-92229)

Discover related pathways, diseases and genes to OR52E2 Antibody (NBP1-92229). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR52E2

There are no specific blogs for OR52E2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OR52E2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OR52E2
Novus 100% Guarantee