Recombinant Human OR2A2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human OR2A2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 261-318 of Human OR2A2

Source: Wheat Germ

Amino Acid Sequence: PDSNQREEQEKMLSLFHSVLNPMLNPLIYSLRNAQLKGALHRALQRKRSMRTVYGLCL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
OR2A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
32.12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OR2A2 Protein

  • Olfactory receptor 2A17
  • olfactory receptor 2A2
  • Olfactory receptor OR7-11
  • olfactory receptor, family 2, subfamily A, member 17 pseudogene
  • olfactory receptor, family 2, subfamily A, member 2 pseudogene
  • olfactory receptor, family 2, subfamily A, member 2
  • OR2A17P
  • OR2A2P
  • OR7-11
  • OST008

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for OR2A2 Partial Recombinant Protein (H00442361-Q01) (0)

There are no publications for OR2A2 Partial Recombinant Protein (H00442361-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR2A2 Partial Recombinant Protein (H00442361-Q01) (0)

There are no reviews for OR2A2 Partial Recombinant Protein (H00442361-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR2A2 Partial Recombinant Protein (H00442361-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OR2A2 Products

Bioinformatics Tool for OR2A2 Partial Recombinant Protein (H00442361-Q01)

Discover related pathways, diseases and genes to OR2A2 Partial Recombinant Protein (H00442361-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR2A2

There are no specific blogs for OR2A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OR2A2 RNAi
H00442361-R02-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OR2A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OR2A2