OR1M1 Antibody - BSA Free

Images

 
Western Blot: OR1M1 Antibody [NBP3-10247] - Western blot analysis of OR1M1 in Mouse Lung lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Product Discontinued
View other related OR1M1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-10247
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

OR1M1 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse OR1M1 (NP_666817.1). Peptide sequence CPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGALKKIINRKIS
Clonality
Polyclonal
Host
Rabbit
Gene
OR1M1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for OR1M1 Antibody - BSA Free

  • olfactory receptor 1M1
  • Olfactory receptor OR19-5
  • olfactory receptor, family 1, subfamily M, member 1
  • OR19-5
  • OR19-6Olfactory receptor 19-6

Background

The olfactory receptor proteins are members of a large family of G protein coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7 transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OR1M1 Antibody (NBP3-10247) (0)

There are no publications for OR1M1 Antibody (NBP3-10247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR1M1 Antibody (NBP3-10247) (0)

There are no reviews for OR1M1 Antibody (NBP3-10247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR1M1 Antibody (NBP3-10247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OR1M1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol OR1M1