Recombinant Human OR1F1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OR1F1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 312 of Human OR1F1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMYFFLSNLSFVDICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAYDHFVAVCHPLHYTAKMTHQLCALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCDVTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTVLKVPSTKGRWKAFSTCGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVVFSV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
OR1F1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OR1F1 Protein

  • Olfactory receptor 16-35
  • olfactory receptor 1F1
  • Olfactory receptor 1F10
  • Olfactory receptor 1F4
  • Olfactory receptor 1F5
  • Olfactory receptor 1F6
  • Olfactory receptor 1F7
  • Olfactory receptor 1F8
  • Olfactory receptor 1F9
  • Olfactory receptor OR16-4
  • olfactory receptor, family 1, subfamily F, member 1
  • olfactory receptor, family 1, subfamily F, member 13 pseudogene
  • olfactory receptor, family 1, subfamily F, member 4
  • olfactory receptor, family 1, subfamily F, member 5
  • olfactory receptor, family 1, subfamily F, member 6
  • olfactory receptor, family 1, subfamily F, member 7
  • olfactory receptor, family 1, subfamily F, member 9
  • Olfmf
  • OLFMFolfactory receptor, family 1, subfamily F, member 10
  • OR16-35
  • OR16-36
  • OR16-37
  • OR16-88
  • OR16-89
  • OR16-90
  • OR1F10
  • OR1F13P
  • OR1F4
  • OR1F5
  • OR1F6
  • OR1F7
  • OR1F8
  • OR1F9
  • OR3-145
  • ORL1023

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for OR1F1 Recombinant Protein (H00004992-P01) (0)

There are no publications for OR1F1 Recombinant Protein (H00004992-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR1F1 Recombinant Protein (H00004992-P01) (0)

There are no reviews for OR1F1 Recombinant Protein (H00004992-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR1F1 Recombinant Protein (H00004992-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OR1F1 Products

OR1F1 H00004992-P01

Bioinformatics Tool for OR1F1 Recombinant Protein (H00004992-P01)

Discover related pathways, diseases and genes to OR1F1 Recombinant Protein (H00004992-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR1F1

There are no specific blogs for OR1F1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OR1F1 RNAi
H00004992-R02-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OR1F1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OR1F1