Recombinant Human OR1E1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human OR1E1 Protein [H00008387-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human OR1E1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-314 of Human OR1E1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAYDRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGALSRVIHQKKTFFSL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
OR1E1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
61.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OR1E1 GST (N-Term) Protein

  • HGM071
  • Olfactory receptor 13-66
  • Olfactory receptor 17-2/17-32
  • olfactory receptor 1E1
  • Olfactory receptor 1E5
  • Olfactory receptor 1E6
  • Olfactory receptor 5-85
  • Olfactory receptor OR17-18
  • olfactory receptor OR17-4
  • olfactory receptor, family 1, subfamily E, member 1
  • olfactory receptor, family 1, subfamily E, member 5
  • olfactory receptor, family 1, subfamily E, member 6
  • olfactory receptor, family 1, subfamily E, member 8 pseudogene
  • olfactory receptor, family 1, subfamily E, member 9 pseudogene
  • Olfactory receptor-like protein HGMP07I
  • OR13-66OR1E6
  • OR17-2OR1E9P
  • OR17-32OR5-85
  • OR1E5
  • OR1E8P
  • OST547

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for OR1E1 Recombinant Protein (H00008387-P01) (0)

There are no publications for OR1E1 Recombinant Protein (H00008387-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR1E1 Recombinant Protein (H00008387-P01) (0)

There are no reviews for OR1E1 Recombinant Protein (H00008387-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR1E1 Recombinant Protein (H00008387-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OR1E1 Products

Array H00008387-P01

Blogs on OR1E1

There are no specific blogs for OR1E1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OR1E1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OR1E1