N4BP2L1 Antibody - Azide and BSA Free

Images

 
Western Blot: N4BP2L1 Antibody [NBP2-94417] - Analysis of extracts of Mouse liver, using N4BP2L1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per ...read more

Product Details

Summary
Product Discontinued
View other related N4BP2L1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-94417
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

N4BP2L1 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human N4BP2L1 (NP_001073159). FRKHLYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
N4BP2L1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for N4BP2L1 Antibody - Azide and BSA Free

  • CG018
  • CG081
  • NEDD4 binding protein 2-like 1
  • NEDD4-binding protein 2-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for N4BP2L1 Antibody (NBP2-94417) (0)

There are no publications for N4BP2L1 Antibody (NBP2-94417).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N4BP2L1 Antibody (NBP2-94417) (0)

There are no reviews for N4BP2L1 Antibody (NBP2-94417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for N4BP2L1 Antibody (NBP2-94417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N4BP2L1 Products

Research Areas for N4BP2L1 Antibody (NBP2-94417)

Find related products by research area.

Blogs on N4BP2L1

There are no specific blogs for N4BP2L1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N4BP2L1 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol N4BP2L1