MRG-1 Antibody

Western Blot: MRG-1 Antibody [49130002] This image is specific to animal number SDQ4068 1:3,000 of 0.5 mg/ml stock

Immunocytochemistry/Immunofluorescence: MRG-1 Antibody [49130002] - This image is specific to animal number SDQ3927 1:5000 of 0.5 mg/ml stock

Product Discontinued

MRG-1 Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment
• Epitope: MSSKKNFEVGENVACIYKGKPYDAKITDIKTNSDGKELYCVHFKGWNNRYDEKIPVGEEKDRIFKGTASEYAEKHNAELPTT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: mrg-1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunoprecipitation
  • Western Blot 1:100-1:2000
• Application Notes: Use in WB reported in scientific literature (PMID:10.7554/eLife.63300)

Reactivity Notes

Use in C. elegan reported in scientific literature (PMID:10.7554/eLife.63300).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for MRG-1 Antibody

• mrg-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRG-1 Antibody (49130002)(7)

Publications using 49130002

• Delaney CE, Methot SP, Guidi M et al. Heterochromatic foci and transcriptional repression by an unstructured MET-2/SETDB1 co-factor LIN-65 J. Cell Biol. 2019-03-04 [PMID: 30737265] (WB, C. elegans)
• Hajduskova M, Baytek G, Kolundzic E et al. MRG-1/MRG15 Is a Barrier for Germ Cell to Neuron Reprogramming in Caenorhabditis elegans. Genetics. 2018-11-13 [PMID: 30425042] (IP, C. elegans)
• Gupta P, Leahul L, Wang X et al. Proteasome regulation of the chromodomain protein MRG-1 controls the balance between proliferative fate and differentiation in the C. elegans germ line Development. 2015-01-15 [PMID: 25564623] (IP, WB, IHC-Fr, C. elegans)
  
  Details:
  MRG-1 antibody used for IHC-Fr on C. elegans wild-type and rfp-1(ok572) mutant gonads - five to eight minutes/RT fixation in 3% paraformaldehyde , post-fixation in 100% methanol -20C ON , 1 hour/RT blocking in 30% goat serum, primary antibody used at 1:1000 with ON 4C incubation (Fig 7C). IHC-Fr also performed on N2 (wild-type), mrg-1(RNAi) and mrg-1(tm1227) M+Z- animals (Figure S2B). Antibody also used for WB on N2 (wild type) C. elegans as well as the mutants pas-5(oz237) and rfp-1(ok572), and on C. elegans treated with lactacystin, a proteasome inhibitor (Fig 7A, 7B). WB also performed on N2 wild type in comparasion to MRG1-RNAi, MRG1 M+Z- and MRG1 M+Z+ (Figure S2A). Antibody also used for IP application on wild-type animals treated or not with Lactacystin (Figure S4).
• Kim H, Ding Y, Lu S et al. PIE-1 promotes SUMOylation and activation of HDAC1 during the C. elegans oogenesis bioRxiv 2020-08-18 (WB, C. elegans)
• Delaney CE, Methot SP, Kalck V et al. SETDB1-like MET-2 promotes transcriptional silencing and development independently of its H3K9me-associated catalytic activity Nature structural & molecular biology 2022-02-01 [PMID: 35102319] (WB)
• Kim H, Ding YH, Lu S et al. PIE-1 SUMOylation promotes germline fates and piRNA-dependent silencing in C. elegans eLife 2021-05-18 [PMID: 34003111] (WB)
• Kim H, Ding YH, Zhang G et al. HDAC1 SUMOylation promotes Argonaute-directed transcriptional silencing in C. elegans eLife 2021-05-18 [PMID: 34003109] (WB)

Review for MRG-1 Antibody (49130002) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: David Hansen IF Other 06/14/2015

Summary

• Application: Immunofluorescence
• Species: Other
• Lot: G3048-220A01

Bioinformatics

• Gene Symbol: mrg-1
• Entrez:
  • 176702(C. elegans)
• Uniprot:
  • Y37D8A.9(C. elegans)