MRG-1 Antibody

Product Discontinued

MRG-1 Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment
• Epitope: ALKPKKKSLAAEAPRDDRDDTPGTSKGKKAKSVTIAPVMTADDMKVELPKPLRKILIDDYDLVCRYFINIVPHEYSVDQIIEDYIKTIPVSNEQMRTVDD
• Specificity: Caenorhabditis elegans MRG1
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: mrg-1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
• Application Notes: This product is useful for ELISA and for Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for MRG-1 Antibody

• mrg-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRG-1 Antibody (35530002)(1)

Publication using 35530002

• Beurton F, Stempor P, Caron M et al. Physical and functional interaction between SET1/COMPASS complex component CFP-1 and a Sin3S HDAC complex in C. elegans Nucleic Acids Res. 2019-10-11 [PMID: 31602465] (IP, C. elegans)

Bioinformatics

• Gene Symbol: mrg-1
• Entrez:
  • 176702(C. elegans)
• Uniprot:
  • Y37D8A.9(C. elegans)