MPV17L2 Antibody

Product Discontinued

MPV17L2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to FKSG24(hypothetical protein MGC12972) The peptide sequence was selected from the N terminal of FKSG24. Peptide sequence PFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGC.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPV17L2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against FKSG24 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MPV17L2 Antibody

• FKSG24

Background

FKSG24 is a multi-pass membrane proteinPotential. It belongs to the peroxisomal membrane protein PXMP2/4 family. The exact function of FKSG24 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPV17L2
• Uniprot:
  • Q567V2(Human)