METTL10 Antibody


Western Blot: METTL10 Antibody [NBP2-14232] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: METTL10 Antibody [NBP2-14232] - Staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: METTL10 Antibody [NBP2-14232] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

METTL10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFR EYGDTGEIWFGEESMNRLIRWMQKHKIPL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
METTL10 Protein (NBP2-14232PEP)

Alternate Names for METTL10 Antibody

  • C10orf138
  • chromosome 10 open reading frame 138
  • EC 2.1.1.-
  • Em:AC068896.3
  • FLJ13019
  • methyltransferase like 10
  • methyltransferase-like protein 10


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for METTL10 Antibody (NBP2-14232) (0)

There are no publications for METTL10 Antibody (NBP2-14232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL10 Antibody (NBP2-14232) (0)

There are no reviews for METTL10 Antibody (NBP2-14232). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for METTL10 Antibody (NBP2-14232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional METTL10 Antibody Products

Bioinformatics Tool for METTL10 Antibody (NBP2-14232)

Discover related pathways, diseases and genes to METTL10 Antibody (NBP2-14232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on METTL10

There are no specific blogs for METTL10, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol METTL10

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-14232 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought