METTL10 Antibody

Images

 
Western Blot: METTL10 Antibody [NBP2-14232] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: METTL10 Antibody [NBP2-14232] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: METTL10 Antibody [NBP2-14232] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: METTL10 Antibody [NBP2-14232] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: METTL10 Antibody [NBP2-14232] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: METTL10 Antibody [NBP2-14232] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Product Discontinued
View other related METTL10 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-14232
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

METTL10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHKIPL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for METTL10 Antibody

  • C10orf138
  • chromosome 10 open reading frame 138
  • EC 2.1.1.-
  • Em:AC068896.3
  • FLJ13019
  • methyltransferase like 10
  • methyltransferase-like protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for METTL10 Antibody (NBP2-14232) (0)

There are no publications for METTL10 Antibody (NBP2-14232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL10 Antibody (NBP2-14232) (0)

There are no reviews for METTL10 Antibody (NBP2-14232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for METTL10 Antibody (NBP2-14232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our METTL10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL10