METTL10 Antibody

Images

 
Western Blot: METTL10 Antibody [NBP2-14232] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: METTL10 Antibody [NBP2-14232] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: METTL10 Antibody [NBP2-14232] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

METTL10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFR EYGDTGEIWFGEESMNRLIRWMQKHKIPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
METTL10 Protein (NBP2-14232PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for METTL10 Antibody

  • C10orf138
  • chromosome 10 open reading frame 138
  • EC 2.1.1.-
  • Em:AC068896.3
  • FLJ13019
  • methyltransferase like 10
  • methyltransferase-like protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for METTL10 Antibody (NBP2-14232) (0)

There are no publications for METTL10 Antibody (NBP2-14232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL10 Antibody (NBP2-14232) (0)

There are no reviews for METTL10 Antibody (NBP2-14232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for METTL10 Antibody (NBP2-14232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional METTL10 Products

Bioinformatics Tool for METTL10 Antibody (NBP2-14232)

Discover related pathways, diseases and genes to METTL10 Antibody (NBP2-14232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on METTL10

There are no specific blogs for METTL10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our METTL10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL10