mes-4 Antibody

Western Blot: mes-4 Antibody [29400002] - This image is specific to animal number SDQ0797

Immunocytochemistry/Immunofluorescence: mes-4 Antibody [29400002] - This image is specific to animal number SDQ0797

Chromatin Immunoprecipitation: mes-4 Antibody [29400002] - MES-4 ChIP-qPCR using L4 C. elegans Chromatin Extract. Image from confirmed customer review.

Western Blot: mes-4 Antibody [29400002] - This image is specific to animal number SDQ0791

Immunocytochemistry/Immunofluorescence: mes-4 Antibody [29400002] - This image is specific to animal number SDQ0791 1:25,000-50,000 of 0.5 mg/ml stock 1:50000 Affinity Purified [AD]

Product Discontinued

mes-4 Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment from MES4
• Epitope: GTASKKSEISPSKPSTSSASSTSFVQQASWPISQNKKNLKKNSNQPVADTGSTLSTSTELNFHEKPQELLSPVSSRSRAASSSTPRAQKSKSRRDDVESE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MES4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation 1:10-1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry
  • Western Blot 1:100-1:2000
• Application Notes: This antibody works in Chromatin Immunoprecipitation (animal number SDQ0791 only), ELISA and Immunofluorescence.Use in Immunohistochemistry reported in scientific literature (PMID 24252776)

Reactivity Notes

C. elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1.0 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for mes-4 Antibody (29400002)(4)

Publications using 29400002

• Garrison C, Lastwika K, Zhang Y et al. Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections With Obesity J Proteome Res. 2017-01-06 [PMID: 27769113] (MiAr)
  
  Details:
  Analysis is performed on plasma proteomic data to identify how obesity can alter pathways and to highlight the risk factor for disease in subjects with a high body mass index.
• Cecere G, Hoersch S, O'Keeffe S et al. Global effects of the CSR-1 RNA interference pathway on the transcriptional landscape. Nat. Struct. Mol. Biol. 2014-04-01 [PMID: 24681887] (Chemotaxis, C. elegans)
• Custer LM, Snyder MJ, Flegel K, Csankovszki G. The onset of C. elegans dosage compensation is linked to the loss of developmental plasticity. Dev Biol. 2013-11-16 [PMID: 24252776] (ICC/IF, IF/IHC, C. elegans)
• Rho JH, Lampe PD. High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays J Proteome Res. 2013-05-03 [PMID: 23541305] (MiAr)
  
  Details:
  A novel method using antibody microarrays is used to detect autoantibody-antigen complexes that can potentially be useful for detection and characterization of diseases.

Review for mes-4 Antibody (29400002) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: Verified Customer ChIP Other 06/19/2014

Summary

• Application: Chromatin Immunoprecipitation
• Species: Other
• Lot: SDQ0791

Bioinformatics

• Gene Symbol: MES4
• Uniprot:
  • Y2H9A.1(C. elegans)