mes-3 Antibody Summary
| Immunogen |
In vivo generated recombinant protein fragment MES3 |
| Epitope |
YVYMNRANDLVPQLNGEENGKIEGLMEAYPMNNAHMYSDIEFLRKEKLNLPKNAQKYGEMTILDYPLTKTETDEYNKKMSVMNVKDFAVKPRKPIPTVGN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MES-3 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:10-1:2000
|
| Application Notes |
This antibody works in Immunofluorescence. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative |
No Preservative |
| Purity |
Immunogen affinity purified |
Notes
This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.
Alternate Names for mes-3 Antibody
Background
Component of a Polycomb group (PcG) complex. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. The mes-2/mes-3/mes-6 complex may participate in the global inactivation of the X chromosomes in germline cells. The complex may act via methylation of histone H3 'Lys-27', rendering chromatin heritably changed in its expressibility. This complex is required to exclude mes-4 from the inactivated X-chromosomes in germline cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for mes-3 Antibody (49100002) (0)
There are no publications for mes-3 Antibody (49100002).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for mes-3 Antibody (49100002) (0)
There are no reviews for mes-3 Antibody (49100002).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for mes-3 Antibody (49100002) (0)
Secondary Antibodies
| |
Isotype Controls
|
Research Areas for mes-3 Antibody (49100002)
Find related products by research area.
|
Blogs on mes-3