We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

mes-3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: mes-3 Antibody [49100002] - This image is specific to animal number SDQ4065 1:2000 of 0.5 mg/ml stock

Product Details

Summary
Product Discontinued
View other related mes-3 Primary Antibodies

Order Details


    • Catalog Number
      49100002
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

mes-3 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment MES3
Epitope
YVYMNRANDLVPQLNGEENGKIEGLMEAYPMNNAHMYSDIEFLRKEKLNLPKNAQKYGEMTILDYPLTKTETDEYNKKMSVMNVKDFAVKPRKPIPTVGN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MES-3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
Application Notes
This antibody works in Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for mes-3 Antibody

  • mes3

Background

Component of a Polycomb group (PcG) complex. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. The mes-2/mes-3/mes-6 complex may participate in the global inactivation of the X chromosomes in germline cells. The complex may act via methylation of histone H3 'Lys-27', rendering chromatin heritably changed in its expressibility. This complex is required to exclude mes-4 from the inactivated X-chromosomes in germline cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for mes-3 Antibody (49100002) (0)

There are no publications for mes-3 Antibody (49100002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mes-3 Antibody (49100002) (0)

There are no reviews for mes-3 Antibody (49100002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for mes-3 Antibody (49100002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Research Areas for mes-3 Antibody (49100002)

Find related products by research area.

Blogs on mes-3

There are no specific blogs for mes-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mes-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MES-3
Entrez
Uniprot