mes-3 Antibody

Immunocytochemistry/Immunofluorescence: mes-3 Antibody [38580002] - This image is specific to animal number SDQ2360 dilution: 1:2,000 of 0.5 mg/ml stock

Product Discontinued

mes-3 Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment MES3
• Epitope: KSLPSTPTSSEAGSSRESSNPVTSSSRRKNPPTKLENIQKTLPTCSDGLEIRNYVKKYGLPEDNKFLVRNVFDKQLLFGKKYVCRRRVIKSIDEFFPRLK
• Specificity: This MES3 antibody is specific for C. Elegans MES3.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MES-3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
• Application Notes: This product is useful for ELISA and for Immunofluorescence.

Reactivity Notes

C.elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for mes-3 Antibody

• mes3

Background

Component of a Polycomb group (PcG) complex. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. The mes-2/mes-3/mes-6 complex may participate in the global inactivation of the X chromosomes in germline cells. The complex may act via methylation of histone H3 'Lys-27', rendering chromatin heritably changed in its expressibility. This complex is required to exclude mes-4 from the inactivated X-chromosomes in germline cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for mes-3 Antibody (38580002)(2)

Publications using 38580002

• Garrison C, Lastwika K, Zhang Y et al. Proteomic Analysis, Immune Dysregulation and Pathway Interconnections with Obesity. Journal of Proteome Research Oct 21 2016 [PMID: 27769113] (MiAr)
  
  Details:
  mes-3 Antibody used in microarray creation
• Rho JH, Lampe PD. High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays. Journal of Proteome Research May 3 2014 [PMID: 23541305] (MiAr)
  
  Details:
  Anti-mes-3 used in screening array

Bioinformatics

• Gene Symbol: MES-3
• Entrez:
  • 172123(C. elegans)
• Uniprot:
  • Q10665(C. elegans)